missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DNAH1 (aa 884-964) Control Fragment Recombinant Protein

Product Code. 30194236
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194236

Brand: Invitrogen™ RP96323

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57826 (PA5-57826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an inner dynein arm heavy chain that provides structural support between the radial spokes and the outer doublet of the sperm tail. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and multiple morphological anomalies of the flagella that result in asthenozoospermia and male infertility. Mice with a homozygous knockout of the orthologous gene are viable but have reduced sperm motility and are infertile.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P2D7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25981
Name Human DNAH1 (aa 884-964) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias axonemal beta dynein heavy chain 1; Ciliary dynein heavy chain 1; DHC7; Dlp1; DNAH1; DNAH1 variant protein; Dnahc1; dynein axonemal heavy chain 1; dynein heavy chain 1, axonemal; dynein, axonemal, heavy chain 1; dynein, axonemal, heavy polypeptide 1; hDHC7; Heat shock regulated protein 1; HL11; HL-11; HSRF-1; KIAA1410; RGD1311110; testicular tissue protein Li 60; XLHSRF-1
Common Name DNAH1
Gene Symbol DNAH1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.