Invitrogen™ Human DMTF1 (aa 527-655) Control Fragment Recombinant Protein

Product Code. 30198182

Brand: Invitrogen™ RP89350

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82848 (PA5-82848. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9Y222
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9988
• Name: Human DMTF1 (aa 527-655) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cyclin D binding myb like transcription factor 1; cyclin D binding myb-like transcription factor 1; cyclin D binding myb-like transcription factor 1 D-interacting myb-like protein; cyclin D-binding Myb-like protein; cyclin-D-binding Myb-like transcription factor 1; Cyclin-D-interacting Myb-like protein 1; Dimp; D-interacting myb-like protein; Dmp1; DMTF; Dmtf1; FLJ41265; hDMP1; hDMTF1; mDmp1; MRUL
• Common Name: DMTF1
• Gene Symbol: DMTF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining