Invitrogen™ Human DMRTB1 (aa 19-70) Control Fragment Recombinant Protein

Product Code. 30206161

Brand: Invitrogen™ RP101816

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63586 (PA5-63586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DMRTB1 gene ontology annotations related to this gene include DNA-binding transcription factor activity.

Specifications

• Accession Number: Q96MA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63948
• Name: Human DMRTB1 (aa 19-70) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DMRT like family B with proline rich C-terminal 1; Dmrt6; Dmrtb1; DMRT-like family B with proline-rich C-terminal 1; DMRT-like family B with proline-rich C-terminal, 1; doublesex and mab-3 related transcription factor 6; doublesex- and mab-3-related transcription factor 6; Doublesex- and mab-3-related transcription factor B1; proline-rich protein 13; Prp13; RGD1560921
• Common Name: DMRTB1
• Gene Symbol: DMRTB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining