Invitrogen™ Human DMRTA1 (aa 270-353) Control Fragment Recombinant Protein

Product Code. 30180593

Brand: Invitrogen™ RP99927

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60821 (PA5-60821. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DMRTA1 (DMRT Like Family A1) is a Protein Coding gene. Diseases associated with DMRTA1 include Bartholin's Duct Cyst and Cardiomyopathy, Dilated, 1J. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and sequence-specific DNA binding. An important paralog of this gene is DMRTA2. [GeneCards]

Specifications

• Accession Number: Q5VZB9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63951
• Name: Human DMRTA1 (aa 270-353) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DMO; DMRT like family A1; DMRT4; Dmrta1; DMRT-like family A1; doublesex and mab-3 related transcription factor 4; doublesex and mab-3 related transcription factor like family A1; doublesex- and mab-3-related transcription factor 4; Doublesex- and mab-3-related transcription factor A1
• Common Name: DMRTA1
• Gene Symbol: DMRTA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YSNKPDSILSPHPGEQSGGEESPRSLSSSDLESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining