Invitrogen™ Human DMPK (aa 386-525) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30210368	100 μL	100µL

Product Code. 30210368 Supplier Invitrogen™ Supplier No. RP89749

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52393 (PA5-52393. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DMPK is a serine/threonine kinase expressed in various muscle and nerve tissues. Mutations in the untranslated region of the DMPK gene are a characteristic of myotonic dystrophy. The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-37 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region.

Specifications

• Accession Number: Q09013
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1760
• Name: Human DMPK (aa 386-525) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DM; DM protein kinase; DM1; DM1 protein kinase; Dm15; DM1PK; DMK; DM-kinase; Dmpk; dystrophia myotonica kinase, B15; dystrophia myotonica protein kinase; dystrophia myotonica-protein kinase; MDPK; MT-Pk.; myotonic dystrophy associated protein kinase; myotonic dystrophy protein kinase; myotonin protein kinase A; myotonin-protein kinase; thymopoietin homolog
• Common Name: DMPK
• Gene Symbol: DMPK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTPMELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining