Invitrogen™ Human DMP4 (aa 186-274) Control Fragment Recombinant Protein

Product Code. 30212226

Brand: Invitrogen™ RP92807

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82700 (PA5-82700. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium-binding protein which may play a role in dentin mineralization.

Specifications

• Accession Number: Q8IXL6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56975
• Name: Human DMP4 (aa 186-274) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C76981; Dentin matrix protein 4; DMP4; DMP-4; Extracellular serine/threonine protein kinase FAM20C; Fam20c; family with sequence similarity 20 member C; family with sequence similarity 20, member C; GEF-CK; Golgi casein kinase; golgi-enriched fraction casein kinase; Kiaa4081; mKIAA4081; RGD1311980; RNS
• Common Name: DMP4
• Gene Symbol: FAM20C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining