Invitrogen™ Human DMC1 (aa 193-332) Control Fragment Recombinant Protein

Product Code. 30210110

Brand: Invitrogen™ RP91372

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81926 (PA5-81926. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DMC1 is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this protein is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes.

Specifications

• Accession Number: Q14565
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11144
• Name: Human DMC1 (aa 193-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DCM1; disrupted meiotic cDNA 1 homolog; disrupted meiotic cDNA1, yeast, homolog of; dJ199H16.1; DMC 1; DMC1; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination; DMC1 homologue; DMC1H; DNA meiotic recombinase 1; HsLim15; LIM15; Mei11; Meiotic recombination protein DMC1/LIM15 homolog; MGC150472; MGC150473; RP1-199H16.4; sgdp
• Common Name: DMC1
• Gene Symbol: DMC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining