missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211456

Invitrogen™ Human DLK1 (aa 239-303) Control Fragment Recombinant Protein

Product Code. 30211456
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211456

Brand: Invitrogen™ RP101578

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Delta-like 1 homolog (DLK1) is a transmembrane protein containing six epidermal growth factor repeats. It is involved in the differentiation of several cell types, including adipocytes and is also thought to be a tumor suppressor. The DLK1 gene is one of several imprinted genes located in a region on chromosome 14q32; certain mutations in this imprinted region can cause phenotypes similar to maternal and paternal uniparental disomy of chromosome 14 (UPD14). DLK1 is expressed from the paternal allele; a polymorphism within this gene has been associated with child and adolescent obesity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P80370
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8788
Name Human DLK1 (aa 239-303) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Adipocyte differentiation inhibitor protein; AW742678; delta like non-canonical Notch ligand 1; Delta1; delta-like 1 homolog; delta-like 1 homolog (Drosophila); DLK; Dlk1; DLK-1; DlkI; FA1; Fetal antigen 1; Ly107; Peg9; pG2; Preadipocyte factor 1; preadipocyte factor-1; PREF; Pref1; pref-1; Protein delta homolog 1; SCP1; Scp-1; secredeltin; stromal cell derived protein 1; ZOG
Common Name DLK1
Gene Symbol DLK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.