Invitrogen™ Human DKK4 (aa 98-160) Control Fragment Recombinant Protein

Product Code. 30206667

Brand: Invitrogen™ RP93767

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84130 (PA5-84130. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modulated by binding to the Wnt co-receptor and the co-factor kremen 2.

Specifications

• Accession Number: Q9UBT3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27121
• Name: Human DKK4 (aa 98-160) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Dickkopf gene 4; dickkopf homolog 4 (Xenopus laevis); dickkopf WNT signaling pathway inhibitor 4; dickkopf-4; Dickkopf-related protein 4; Dickkopf-related protein 4 short form; DKK4; Dkk-4; hDkk-4; MGC129562; MGC129563
• Common Name: DKK4
• Gene Symbol: DKK4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining