missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197007

Invitrogen™ Human DIXDC1 (aa 558-648) Control Fragment Recombinant Protein

Product Code. 30197007
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197007

Brand: Invitrogen™ RP110136

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144895 (PA5-144895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q155Q3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85458
Name Human DIXDC1 (aa 558-648) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930563F16Rik; BC048182; ccd1; Ccd1Aalpha1L; Ccd1Abeta1L; Ccd1BalphaL; Ccd1BbetaL; Ccd1CL; coiled-coil DIX 1; coiled-coil protein DI x 1; Coiled-coil protein DI x 1-A; coiled-coil-DI x 1; Coiled-coil-DI x 1-A; DIX domain containing 1; DIX domain containing 1 A; DIX domain-containing protein 1; DIX domain-containing protein 1-A; Dixdc1; dixdc1a; Dixin; dixin-A; EGK_06890; Kiaa1735; mKIAA1735
Common Name DIXDC1
Gene Symbol Dixdc1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.