Invitrogen™ Human DIS3L2 (aa 102-194) Control Fragment Recombinant Protein

Product Code. 30209905

Brand: Invitrogen™ RP102680

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83288 (PA5-83288. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DIS3L2 encodes a protein that is similar in sequence to 3'/5' exonucleolytic subunits of the RNA exosome. The exosome is a large multimeric ribonucleotide complex responsible for degrading various RNA substrates. Several transcript variants, some protein-coding and some not, have been found for this gene.

Specifications

• Accession Number: Q8IYB7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 129563
• Name: Human DIS3L2 (aa 102-194) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930429A22Rik; 8030493P09Rik; DIS3 like 3'-5' exoribonuclease 2; DIS3 mitotic control homolog (S. cerevisiae)-like 2; DIS3 mitotic control homolog-like 2; DIS3 mitotic control-like 2; Dis3l2; DIS3-like 3'-5' exoribonuclease 2; DIS3-like exonuclease 2; FAM6A; family with sequence similarity 6, member A; hDIS3L2; PRLMNS; RGD1560168
• Common Name: DIS3L2
• Gene Symbol: DIS3L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining