Invitrogen™ Human DIS3L (aa 103-201) Control Fragment Recombinant Protein

Code produit. 30180635

missing translation for 'mfr': Invitrogen™ RP98155

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59739 (PA5-59739. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DIS3L is a probable exonuclease. It has four isoforms.

Spécification

• Accession Number: Q8TF46
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 115752
• Name: Human DIS3L (aa 103-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV340375; DIS3 like exosome 3'-5' exoribonuclease; DIS3 mitotic control homolog (S. cerevisiae)-like; DIS3 mitotic control homolog-like; Dis3l; DIS3L1; DIS3-like exonuclease 1; DIS3-like exosome 3'-5' exoribonuclease; KIAA1955; RGD1308959
• Common Name: DIS3L
• Gene Symbol: DIS3L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining