Invitrogen™ Human DIRC2 (aa 136-187) Control Fragment Recombinant Protein

Product Code. 30208424

Brand: Invitrogen™ RP107887

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67249 (PA5-67249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Electrogenic metabolite transporter.

Specifications

• Accession Number: Q96SL1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84925
• Name: Human DIRC2 (aa 136-187) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Dirc2; Disrupted in renal cancer protein 2; disrupted in renal carcinoma 2; disrupted in renal carcinoma 2 (human); disrupted in renal carcinoma 2 homolog; disrupted in renal carcinoma protein 2; Disrupted in renal carcinoma protein 2 homolog; RCC4; renal cell carcinoma 4; SLC49A4; Solute carrier family 49 member 4
• Common Name: DIRC2
• Gene Symbol: Dirc2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining