Invitrogen™ Human DIRC1 (aa 57-102) Control Fragment Recombinant Protein

Product Code. 30209347

Brand: Invitrogen™ RP108541

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84782 (PA5-84782. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene consists of two exons and encodes a 104aa protein. Disruption of this gene by translocation t(2;3)(q33;q21) is associated with familial clear cell renal cancer.

Specifications

• Accession Number: Q969H9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116093
• Name: Human DIRC1 (aa 57-102) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DIRC1; disrupted in renal cancer protein; disrupted in renal carcinoma 1; disrupted in renal carcinoma protein 1
• Common Name: DIRC1
• Gene Symbol: DIRC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining