Invitrogen™ Human DIP2C (aa 123-255) Control Fragment Recombinant Protein

Product Code. 30208815

Brand: Invitrogen™ RP92422

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56419 (PA5-56419. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the disco-interacting protein homolog 2 family. The protein shares strong similarity with a Drosophila protein which interacts with the transcription factor disco and is expressed in the nervous system.

Specifications

• Accession Number: Q9Y2E4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22982
• Name: Human DIP2C (aa 123-255) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900024P20Rik; 9630044M06; DIP2 disco-interacting protein 2 homolog C; DIP2 disco-interacting protein 2 homolog C (Drosophila); DIP2 homolog C; DIP2C; disco interacting protein 2 homolog C; disco-interacting protein 2 homolog C; KIAA0934; mKIAA0934; RGD1560155
• Common Name: DIP2C
• Gene Symbol: DIP2C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSMDAYTPPDTSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDVTTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETGDGVPVSSRVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining