Invitrogen™ Human DIABLO (aa 106-224) Control Fragment Recombinant Protein

Product Code. 30212637

Brand: Invitrogen™ RP101900

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110645 (PA5-110645. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DIABLO (smac), a mitochondrial protein, activates various forms of apoptosis. This activation may be due to the neutralization of one or more members of the IAP family of apoptosis inhibitory proteins. Smac exits the mitochondria and enter the cytosol during certain apoptosis triggered events. Mitochondrial-mediated apoptosis is important in animal development and tissue homeostasis, with alterations resulting in a range of malignant disorders. Upon apoptotic stimuli, the mitochondrial proteins cytochrome c and Smac/DIABLO are released into the cytosol. The release of these proteins, however, occurs via different mechanisms. Smac/DIABLO has also been found to play a key role in regulating the sensitization of cancer cells to apoptosis (both immune and drug-induced).

Specifications

• Accession Number: Q9NR28
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56616
• Name: Human DIABLO (aa 106-224) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610041G12Rik; 1700006L01Rik; AU040403; DFNA64; DIABLO; diablo homolog (Drosophila); diablo homolog, mitochondrial; diablo IAP-binding mitochondrial protein; diablo, IAP-binding mitochondrial protein; diablo-like protein; DIABLO-S; direct IAP binding protein with low PI; direct IAP-binding protein with low pI; FLJ10537; FLJ25049; hCG_1782202; Second mitochondria-derived activator of caspase; Smac; Smac protein; SMAC3
• Common Name: SMAC
• Gene Symbol: DIABLO
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining