Invitrogen™ Human DHTKD1 (aa 106-181) Control Fragment Recombinant Protein

Product Code. 30195014

Brand: Invitrogen™ RP105380

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84706 (PA5-84706. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Specifications

• Accession Number: Q96HY7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55526
• Name: Human DHTKD1 (aa 106-181) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AMOXAD; C330018I04Rik; CMT2Q; dehydrogenase E1 and transketolase domain containing 1; dehydrogenase E1 and transketolase domain-containing protein 1; Dhtkd1; DKFZp762M115; KIAA1630; MGC3090; Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
• Common Name: DHTKD1
• Gene Symbol: DHTKD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining