Invitrogen™ Human DHRS3 (aa 72-184) Control Fragment Recombinant Protein

Product Code. 30203132

Brand: Invitrogen™ RP90377

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52750 (PA5-52750. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DHRS3 catalyze the oxidation/reduction of a wide range of substrates, including retinoids and steroids.

Specifications

• Accession Number: O75911
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9249
• Name: Human DHRS3 (aa 72-184) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DD83.1; dehydrogenase/reductase (SDR family) member 3; dehydrogenase/reductase 3; dehydrogenase/reductase member 3; Dhrs3; RDH17; retinal dehydrogenase/reductase family member 3; retinal short-chain dehydrogenase/reductase 1; Retinol dehydrogenase 17; retSDR1; Rsdr1; SDR1; SDR16C1; Short chain dehydrogenase/reductase family 16 C member 1; short chain dehydrogenase/reductase family 16 C, member 1; short-chain dehydrogenase/reductase 1; short-chain dehydrogenase/reductase 3; UNQ2424/PRO4983
• Common Name: DHRS3
• Gene Symbol: Dhrs3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining