Invitrogen™ Human DHRS13 (aa 299-377) Control Fragment Recombinant Protein

Product Code. 30213135

Brand: Invitrogen™ RP93375

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54657 (PA5-54657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative oxidoreductase.

Specifications

• Accession Number: Q6UX07
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 147015
• Name: Human DHRS13 (aa 299-377) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610209N15Rik; androgen-regulated short-chain dehydrogenase/reductase 1; prostate short-chain dehydrogenase reductase 1; likely ortholog of mouse cell line MC/9.IL4 derived transcript 1; CGI-82 protein; HCV core-binding protein; dehydrogenase/reductase (SDR family) member 13; dehydrogenase/reductase 13; dehydrogenase/reductase SDR family member 13; Dhrs13; RGD1305508; SDR7C5; Short chain dehydrogenase/reductase family 7 C member 5; short chain dehydrogenase/reductase family 7 C, member 5; UNQ419/PRO853
• Common Name: DHRS13
• Gene Symbol: DHRS13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining