Invitrogen™ Human DHRS11 (aa 31-100) Control Fragment Recombinant Protein

Product Code. 30181323

Brand: Invitrogen™ RP98377

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62819 (PA5-62819. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DHRS11 gene ontology annotations related to this gene include oxidoreductase activity.

Specifications

• Accession Number: Q6UWP2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79154
• Name: Human DHRS11 (aa 31-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 17-beta-hydroxysteroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; ARPG836; dehydrogenase/reductase (SDR family) member 11; dehydrogenase/reductase 11; dehydrogenase/reductase SDR family member 11; DHRS11; Estradiol 17-beta-dehydrogenase; hypothetical protein LOC510264; inactive dehydrogenase/reductase isoform; LOW QUALITY PROTEIN: dehydrogenase/reductase SDR family member 11; RGD1307935; SDR24C1; short chain dehydrogenase/reductase family 24 C, member 1; short-chain dehydrogenase/reductase family 24 C member 1; spDHRS11; UNQ836/PRO1774
• Common Name: DHRS11
• Gene Symbol: DHRS11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining