Invitrogen™ Human DHODH Control Fragment Recombinant Protein

Product Code. 30204199

Brand: Invitrogen™ RP90070

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52880 (PA5-52880. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: Q02127
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1723
• Name: Human DHODH Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810417D19Rik; AI834883; DHOdehase; DHODH; dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate dehydrogenase, mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; POADS; URA1
• Common Name: DHODH
• Gene Symbol: DHODH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining