Invitrogen™ Human DGCR2 (aa 455-549) Control Fragment Recombinant Protein

Product Code. 30195446

Brand: Invitrogen™ RP108063

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67399 (PA5-67399. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Deletions of the 22q11.2 have been associated with a wide range of developmental defects (notably DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome and isolated conotruncal cardiac defects) classified under the acronym CATCH 22. The DGCR2 gene encodes a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

Specifications

• Accession Number: P98153
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9993
• Name: Human DGCR2 (aa 455-549) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9930034O06Rik; Dgcr2; Dgsc; DGS-C; DiGeorge syndrome critical region gene 2; DiGeorge syndrome critical region protein 2; DiGeorge syndrome gene c; DiGeorge syndrome protein C; IDD; integral membrane protein deleted in DiGeorge syndrome; integral membrane protein DGCR2/IDD; KIAA0163; Lan; mKIAA0163; seizure-related membrane-bound adhesion protein; Sez12; Sez-12
• Common Name: DGCR2
• Gene Symbol: DGCR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IHPDSVFYDPADDDAFEPVEVSLPAPGDGGSEGALLRRLEQPLPTAGASLADLEDSADSSSALLVPPDPAQSGSTPAAEALPGGGRHSRSSLNTV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining