Invitrogen™ Human DET1 (aa 34-145) Control Fragment Recombinant Protein

Product Code. 30180856

Brand: Invitrogen™ RP98102

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61826 (PA5-61826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DET1 is a component of the E3 ubiquitin ligase DCX DET1-COP1 complex, which is required for ubiquitination and subsequent degradation of target proteins. The complex is involved in JUN ubiquitination and degradation.

Specifications

• Accession Number: Q7L5Y6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55070
• Name: Human DET1 (aa 34-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610034H20Rik; de-etiolated 1; de-etiolated homolog 1; de-etiolated homolog 1 (Arabidopsis); de-etiolated-1 homolog; DET1; DET1 homolog; DET1 partner of COP1 E3 ubiquitin ligase; DET1, COP1 ubiquitin ligase partner; RGD1309793; wu:fc18d06; zgc:66486
• Common Name: DET1
• Gene Symbol: DET1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining