missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Desmoglein 4 (aa 953-1039) Control Fragment Recombinant Protein

Product Code. 30196111
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196111

Brand: Invitrogen™ RP109937

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Desmoglein proteins are cadherin-type cell adhesion molecules. Desmoglein 4 (dsg4) shares 41% identity with human desmoglein 1, 37% with human desmoglein 2 and 50% with human desmoglein 3. A type I membrane protein of the cadherin protein family, dsg4 is expressed in salivary gland, suprabasal epidermis, hair follicle, testis, prostate and skin. In the hair follicle, dsg4 is an important mediator of keratinocyte cell adhesion and coordinates the transition from proliferation to differentiation. The human DSG4 gene is composed of 16 exons spanning approximately 37 kb of 18q12 and is situated between DSG1 and DSG3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86SJ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 147409
Name Human Desmoglein 4 (aa 953-1039) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cadherin family member 13; CDGF13; CDHF13; desmoglein 4; Desmoglein4; desmoglein-4; DSG4; HYPT6; LAH; lanceolate hair
Common Name Desmoglein 4
Gene Symbol DSG4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.