Invitrogen™ Human DEPDC6 (aa 210-309) Control Fragment Recombinant Protein

Product Code. 30211585

Brand: Invitrogen™ RP93835

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Negative regulator of the mTORC1 and mTORC2 signaling pathways. Inhibits the kinase activity of both complexes.

Specifications

• Accession Number: Q8TB45
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64798
• Name: Human DEPDC6 (aa 210-309) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DEP domain containing 6; DEP domain containing MTOR interacting protein; DEP domain containing MTOR-interacting protein; DEP domain-containing mTOR-interacting protein; DEP domain-containing protein 6; DEP0.6; Depdc6; DEPTOR; Kiaa4200; RGD1561030
• Common Name: DEPDC6
• Gene Symbol: DEPTOR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining