Invitrogen™ Human DENND6B (aa 493-585) Control Fragment Recombinant Protein

Code produit. 30207411

Marque: Invitrogen™ RP92369

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56195 (PA5-56195. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spécification

• Accession Number: Q8NEG7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 414918
• Name: Human DENND6B (aa 493-585) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700027J05Rik; AFI1B; AI414881; DENN domain containing 6 B; DENN domain-containing protein 6 B; DENN/MADD domain containing 6 B; Dennd6b; FAM116B; family with sequence similarity 116, member B; hypothetical protein MGC38041; protein DENND6B; protein FAM116B; RGD1308012
• Common Name: DENND6B
• Gene Symbol: DENND6B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATLQRAQLYIETVIGSLPKDLQAVLCPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining