Invitrogen™ Human DENND4C (aa 1392-1509) Control Fragment Recombinant Protein

Product Code. 30200037

Brand: Invitrogen™ RP91445

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53279 (PA5-53279. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DENND4C is guanine nucleotide exchange factor (GEF) activating RAB10. It promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB10 into its active GTP-bound form. Thereby, stimulates SLC2A4/GLUT4 glucose transporter-enriched vesicles delivery to the plasma membrane in response to insulin.

Specifications

• Accession Number: Q5VZ89
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55667
• Name: Human DENND4C (aa 1392-1509) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700065A05Rik; AA420392; bA513M16.3; C9orf55; C9orf55B; DENN domain containing 4 C; DENN domain-containing protein 4 C; DENN domain-containing protein 4 C-like protein; DENN/MADD domain containing 4 A pseudogene; DENN/MADD domain containing 4 C; Dennd4c; likely ortholog of H. sapiens chromosome 9 open reading frame 55 (C9orf55); RAB10GEF; RGD1308489
• Common Name: DENND4C
• Gene Symbol: DENND4C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining