Invitrogen™ Human DENND1C (aa 531-610) Control Fragment Recombinant Protein

Product Code. 30181174

Brand: Invitrogen™ RP99239

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60144 (PA5-60144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Clathrin-mediated endocytosis is a major mechanism for internalization of proteins and lipids. Members of the connecdenn family, such as DENND1C, function as guanine nucleotide exchange factors (GEFs) for the early endosomal small GTPase RAB35 and bind to clathrin and clathrin adaptor protein-2. Thus, connecdenns link RAB35 activation with the clathrin machinery.

Specifications

• Accession Number: Q8IV53
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79958
• Name: Human DENND1C (aa 531-610) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Connecdenn 3; DENN domain containing 1 C; DENN domain-containing protein 1 C; DENN/MADD domain containing 1 C; DENND1C; FAM31C; family with sequence similarity 31, member C; Protein FAM31C
• Common Name: DENND1C
• Gene Symbol: DENND1C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining