missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205823

Invitrogen™ Human DEGS1 (aa 284-323) Control Fragment Recombinant Protein

Product Code. 30205823
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205823

Brand: Invitrogen™ RP105601

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85000 (PA5-85000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of the DEGS1 gene is a member of the membrane fatty acid (sphingolipid delta 4 ) desaturase family. Reported to function by inserting double bonds at delta 4 position in fatty acids. DEGS1 is an intracellular enzyme. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulation biosynthetic processing of the EGF receptor. Two splice variants have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15121
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8560
Name Human DEGS1 (aa 284-323) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA536663; Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1 (Drosophila); degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte-like protein RDES; Degs; DEGS1; DEGS-1; delta 4-desaturase, sphingolipid 1; Delta(4)-desaturase; delta(4)-desaturase, sphingolipid 1; DES1; Des-1; dihydroceramide desaturase; dihydroceramide desaturase 1; dihydroceramide desaturase-1; DSH1; FADS7; fb81d06; hypothetical protein LOC507290; im:6909319; Mdes; membrane fatty acid (lipid) desaturase; membrane lipid desaturase; MGC5079; MIG15; migration-inducing gene 15 protein; MLD; sphingolipid 1; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; sphingolipid delta(4)-desaturase DES1; wu:fa25h01; wu:fb81d06
Common Name DEGS1
Gene Symbol DEGS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.