Invitrogen™ Human Defensin 6 (aa 21-98) Control Fragment Recombinant Protein

Product Code. 30201839

Brand: Invitrogen™ RP92482

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53992 (PA5-53992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8.

Specifications

• Accession Number: Q01524
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1671
• Name: Human Defensin 6 (aa 21-98) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DEF6; DEFA6; defensin 6; defensin alpha 6; Defensin, alpha 6; defensin, alpha 6, Paneth cell-specific; defensin-6; HD-6
• Common Name: Defensin 6
• Gene Symbol: DEFA6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining