missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180483

Invitrogen™ Human DEFB132 (aa 32-95) Control Fragment Recombinant Protein

Product Code. 30180483
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180483

Brand: Invitrogen™ RP99472

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61233 (PA5-61233. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Beta-defensins (also designated BDs, or hBDs in human) are small cationic peptides with broad-spectrum antimicrobial activity against a variety of enveloped viruses, fungi and bacteria. Produced in mucosal epithelia and neutrophils of several species, beta-defensins are developmentally regulated. The family of beta-defensin proteins share a common defensin-motif that is characterized by multiple cysteine residues and a highly conserved tertiary structure. Besides playing a significant role in host immune defense, many beta-defensins also are involved in sperm maturation and capacitation. beta-defensin 32, also known as beta-defensin 132, is a 95 amino acid secreted protein that most likely contains a signal peptide sequence that requires cleavage by proteolytic enzymes in order to become biologically active.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z7B7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 400830
Name Human DEFB132 (aa 32-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BD-32; Beta-defensin 132; beta-defensin 32; DEFB132; DEFB32; DEFB-32; defensin beta 132; defensin HEL-75; Defensin, beta 132; defensin, beta 32; HEL-75; KFLL827; RP5-1103G7.6; UNQ827; UNQ827/PRO1754
Common Name DEFB132
Gene Symbol DEFB132
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.