Invitrogen™ Human DEFB119 (aa 22-84) Control Fragment Recombinant Protein

Product Code. 30182245

Brand: Invitrogen™ RP99456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60222 (PA5-60222. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q8N690
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 245932
• Name: Human DEFB119 (aa 22-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Beta-defensin 119; beta-defensin 120; Beta-defensin 19; Beta-defensin 20; CBD119; CBD120; DEFB119; DEFB120; DEFB19; DEFB-19; DEFB20; DEFB-20; defensin beta 119; defensin, beta 119; Defensin, beta 120; defensin, beta 19; defensin, beta 20; ESC42-RELA; ESC42-RELB; UNQ2449/PRO5729
• Common Name: DEFB119
• Gene Symbol: DEFB119
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining