Invitrogen™ Human DEF6 (aa 521-610) Control Fragment Recombinant Protein

Product Code. 30211001

Brand: Invitrogen™ RP94601

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58619 (PA5-58619. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEF6, or IBP, is a guanine nucleotide exchange factor for RAC and CDC42 that is highly expressed in B and T cells.

Specifications

• Accession Number: Q9H4E7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50619
• Name: Human DEF6 (aa 521-610) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410003F05Rik; 6430538D02Rik; AV094905; DEF6; DEF-6; DEF6 guanine nucleotide exchange factor; DEF6, guanine nucleotide exchange factor; differentially expressed in FDCP 6; Differentially expressed in FDCP 6 homolog; differentially expressed in FDCP 6 homolog (mouse); Ibp; IRF-4-binding protein; IRF4-binding protein; LOW QUALITY PROTEIN: differentially expressed in FDCP 6 homolog; OTTHUMP00000016251; RP3-329A5.5; SLAT; Slat2; Slat6; SWAP70L; SWAP-70-like adapter of T-cells; SWAP-70-like adaptor protein of T cells
• Common Name: DEF6
• Gene Symbol: DEF6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining