Invitrogen™ Human DEDD (aa 134-195) Control Fragment Recombinant Protein

Product Code. 30195708

Brand: Invitrogen™ RP109948

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144923 (PA5-144923. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEDD encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak apoptosis. Upon stimulation, this protein was found to translocate from cytoplasm to nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: O75618
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9191
• Name: Human DEDD (aa 134-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CASP8IP1; death effector domain containing; death effector domain-containing; death effector domain-containing protein; Death effector domain-containing testicular molecule; DEDD; DEDD1; Dedpro1; DEFT; FLDED1; FLDED-1; KE05; tumor necrosis factor (ligand) superfamily, member 19
• Common Name: DEDD
• Gene Symbol: DEDD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining