Invitrogen™ Human DECR1 (aa 175-254) Control Fragment Recombinant Protein

Product Code. 30196693

Brand: Invitrogen™ RP93763

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110890 (PA5-110890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA.

Specifications

• Accession Number: Q16698
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1666
• Name: Human DECR1 (aa 175-254) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200012F07Rik; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoA reductase [NADPH]; 2,4-dienoyl-CoA reductase 1, mitochondrial; 2,4-dienoyl-CoA reductase, mitochondrial; 4-enoyl-CoA reductase; 4-enoyl-CoA reductase [NADPH]; Decr; DECR1; Nadph; SDR18C1; Short chain dehydrogenase/reductase family 18 C member 1; short chain dehydrogenase/reductase family 18 C, member 1
• Common Name: DECR1
• Gene Symbol: DECR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining