Invitrogen™ Human Decorin (aa 210-336) Control Fragment Recombinant Protein

Product Code. 30209954

Brand: Invitrogen™ RP96778

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Decorin is a member of the small, leucine-rich proteoglycan (SLRP) family along with biglycan. Found in the interterritorial region of cartilage, decorin interacts with collagen and other matrix proteins to regulate the cartilaginous matrix. It has been shown to interact with fibronectin, thrombospondin, C1q, epidermal growth factor receptor (EGFR), and TGF-b. It is believed that decorin also plays a role in the cell cycle of chondrocytes. The decorin neoepitope fragment has a sequence of PKTLQE, and is generated by MMP-3 or ADAMTS-4 cleavage at Glu154-Leu155 of decorin core protein.

Specifications

• Accession Number: P07585
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1634
• Name: Human Decorin (aa 210-336) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Bone proteoglycan II; CSCD; DC; Dcn; DCN protein; DCN1C; Decorin; decorin isoform a preproprotein; Dermatan sulfate proteoglycan-II; dermatan sulfate proteoglycan-II (decorin); dermatan sulphate proteoglycans II; Dermatan sulphate proteoglycans II (DSPG2); DSPG; DSPG2; mDcn; PG40; PGII; PGS2; PG-S2; proteoglycan core protein; proteoglycan core protein; binds type I collagen fibers and TGF-beta; decoron; similar to bone proteoglycan II; similar to decorin; SLRR1B; Small leucine rich protein 1 B; small leucine-rich protein 1 B; unnamed protein product
• Common Name: Decorin
• Gene Symbol: DCN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining