Invitrogen™ Human DDX60L (aa 186-261) Control Fragment Recombinant Protein

Product Code. 30211243

Brand: Invitrogen™ RP106642

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65953 (PA5-65953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the DExD/H-box helicase family of proteins, a subset of the super family 2 helicases. Members of the DExD/H-box helicase family share a conserved functional core comprised of two RecA-like globular domains. These domains contain conserved motifs that mediate ATP binding, ATP hydrolysis, nucleic acid binding, and RNA unwinding. In addition to functions in RNA metabolism, members of this family are involved in anti-viral immunity and act as cytosolic sensors of viral nucleic acids. The protein encoded by this gene has been shown to inhibit hepatitis C virus replication in response to interferon stimulation in cell culture. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q5H9U9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91351
• Name: Human DDX60L (aa 186-261) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DDX60L; DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like; DEAD box protein 60-like; DEAD-box helicase 60-like; probable ATP-dependent RNA helicase DDX60-like; putative ATP-dependent RNA helicase DDX60
• Common Name: DDX60L
• Gene Symbol: DDX60L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKWNDMMEEAYQTLFLLQHLWSEGSDIQR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining