Invitrogen™ Human DDX59 (aa 342-422) Control Fragment Recombinant Protein

Product Code. 30181623

Brand: Invitrogen™ RP99775

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61454 (PA5-61454. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDX59 is a protein coding gene.

Specifications

• Accession Number: Q5T1V6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83479
• Name: Human DDX59 (aa 342-422) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1210002B07Rik; 4833411G06Rik; DDX59; DEAD (Asp-Glu-Ala-Asp) box polypeptide 59; DEAD box protein 59; DEAD-box helicase 59; OFD5; Probable ATP-dependent RNA helicase DDX59; zinc finger HIT domain-containing protein 5; Znhit5
• Common Name: DDX59
• Gene Symbol: DDX59
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining