Invitrogen™ Human DDX54 (aa 303-416) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30193790	100 μL	100µL

Product Code. 30193790 Supplier Invitrogen™ Supplier No. RP89340

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55805 (PA5-55805. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene.

Specifications

• Accession Number: Q8TDD1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79039
• Name: Human DDX54 (aa 303-416) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410015A15Rik; 5-Apr; AI414901; ATP-dependent RNA helicase; ATP-dependent RNA helicase DD x 54; ATP-dependent RNA helicase DP97; chunp6913; Dd x 54; DEAD (Asp-Glu-Ala-Asp) box polypeptide 54; DEAD box helicase 97 KDa; DEAD box protein 54; DEAD box RNA helicase 97 kDa; DEAD-box helicase 54; DP97; LOW QUALITY PROTEIN: ATP-dependent RNA helicase DD x 54; mgc2835; RGD1562539; zgc:111908
• Common Name: DDX54
• Gene Symbol: DDX54
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining