Invitrogen™ Human DDX50 (aa 612-685) Control Fragment Recombinant Protein

Product Code. 30203868

Brand: Invitrogen™ RP97021

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57932 (PA5-57932. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. DDX50 and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. DDX50 gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.

Specifications

• Accession Number: Q9BQ39
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79009
• Name: Human DDX50 (aa 612-685) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933429B04Rik; 8430408E17Rik; ATP-dependent RNA helicase DDX50; ATP-dependent RNA helicase DDX50-like protein; Ddx50; DEAD (Asp-Glu-Ala-Asp) box polypeptide 50; DEAD box protein 50; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 50; DEAD-box helicase 50; DExD-box helicase 50; GU2; GUB; Gubeta; gu-beta; malignant cell derived RNA helicase; mcdrh; Nucleolar protein Gu2; RH-II; RH-II/GuB; RH-II/Gubeta; RNA helicase II/Gu beta; Unknown (protein for IMAGE:8120580)
• Common Name: DDX50
• Gene Symbol: DDX50
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNSRQRSGWSSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining