Invitrogen™ Human DDX4 (aa 233-310) Control Fragment Recombinant Protein

Product Code. 30197215

Brand: Invitrogen™ RP96902

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83387 (PA5-83387. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp, are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9NQI0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54514
• Name: Human DDX4 (aa 233-310) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP-dependent RNA helicase DDX4; AV206478; Cvh; Ddx4; D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 4; DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 4; DEAD (Asp-Glu-Ala-Asp) box polypeptide 4; DEAD box polypeptide 4; DEAD box protein 4; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4; DEAD-box helicase 4; MGC111074; Mvh; mvh / m'vasa; probable ATP-dependent RNA helicase DDX4; putative ATP-dependent RNA helicase DDX4; RVLG; VASA; Vasa homolog; vasa-like gene protein
• Common Name: DDX4
• Gene Symbol: DDX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining