Invitrogen™ Human DDX28 (aa 378-466) Control Fragment Recombinant Protein

Product Code. 30200046

Brand: Invitrogen™ RP106478

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84163 (PA5-84163. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDR11 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is located in the chromosome 10q25-26 region, which is frequently deleted in gliomas and tumors of other tissues, and is disrupted by the t(10;19) translocation rearrangement in glioblastoma cells. The gene location suggests that it is a candidate gene for the tumor suppressor locus.

Specifications

• Accession Number: Q9NUL7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55794
• Name: Human DDX28 (aa 378-466) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410004K13Rik; AI449652; ATP-dependent RNA helicase Ddx28; DDX28; DEAD (Asp-Glu-Ala-Asp) box polypeptide 28; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 28; DEAD-box helicase 28; MDDX28; Mitochondrial DEAD box protein 28; mitochondrial DEAD-box polypeptide 28; probable ATP-dependent RNA helicase DDX28
• Common Name: DDX28
• Gene Symbol: DDX28
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining