Invitrogen™ Human DDX18 (aa 538-629) Control Fragment Recombinant Protein

Product Code. 30207238

Brand: Invitrogen™ RP95994

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57260 (PA5-57260. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP-dependent RNA helicase DDX18 belongs to theDEAD box helicase family, which contains one helicase ATP-binding domain and one helicase C-terminal domain. DDX18 is induced by Myc and Max and is involved in splicing and nuclear export. It is reported to be differentially expressed during viral latency and at early times after induction into active replication.

Specifications

• Accession Number: Q9NVP1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8886
• Name: Human DDX18 (aa 538-629) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP-dependent RNA helicase DDX18; cPERP-D; DDX18; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18; DEAD box protein 18; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated); DEAD-box helicase 18; MrDb; Myc-regulated DEAD box protein
• Common Name: DDX18
• Gene Symbol: DDX18
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRYLKQSKVPLSEFDFSWSKISDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining