Invitrogen™ Human DDR2 (aa 275-349) Control Fragment Recombinant Protein

Product Code. 30196908

Brand: Invitrogen™ RP107731

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111656 (PA5-111656. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDR2 is a member of a subclass of RTKs and contains a distinct extracellular region encompassing a factor VIII-like domain. DDR1 and DDR2 have been shown to be potently inhibited by Gleevec. DDR2 required for normal bone development. Regulates osteoblast differentiation and chondrocyte maturation via a signaling pathway that involves MAP kinases and leads to the activation of the transcription factor RUNX2. Regulates remodeling of the extracellular matrix by up-regulation of the collagenases MMP1, MMP2 and MMP13, and thereby facilitates cell migration and tumor cell invasion. Promotes fibroblast migration and proliferation, and thereby contributes to cutaneous wound healing.

Specifications

• Accession Number: Q16832
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4921
• Name: Human DDR2 (aa 275-349) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW495251; CD_antigen: CD167b; CD167 antigen-like family member B; CD167b; CD167b antigen; cell migration-inducing protein 20; Ddr2; Discoidin domain receptor 2; discoidin domain receptor family, member 2; discoidin domain receptor tyrosine kinase 2; discoidin domain-containing receptor 2; Discoidin domain-containing receptor tyrosine kinase 2; hydroxyaryl-protein; hydroxyaryl-protein kinase; MIG20a; migration-inducing gene 16 protein; neurotrophic tyrosine kinase receptor related 3; neurotrophic tyrosine kinase, receptor-related 3; Ntrkr3; receptor protein-tyrosine kinase TKT; RP11-572K18.1; TKT; TYRO10; tyrosine-protein kinase TYRO 10; tyrosine-protein kinase TYRO10; tyrosylprotein kinase
• Common Name: DDR2
• Gene Symbol: Ddr2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining