Invitrogen™ Human DDO (aa 239-333) Control Fragment Recombinant Protein

Product Code. 30212518

Brand: Invitrogen™ RP95046

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57989 (PA5-57989. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDO is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction.

Specifications

• Accession Number: Q99489
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8528
• Name: Human DDO (aa 239-333) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330420D20Rik; 5730402C02Rik; AI467244; aspartic oxidase; DASOX; D-aspartate oxidase; D-aspartate oxidase, DDO; Ddo; DDO protein; DDO-1; DDO-2
• Common Name: DDO
• Gene Symbol: DDO
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining