Invitrogen™ Human DDI1 (aa 362-394) Control Fragment Recombinant Protein

Product Code. 30197280

Brand: Invitrogen™ RP101466

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140306 (PA5-140306. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ddi1 (DNA-damage inducible 1)appears to release substrate from an ubiquitination complex, making the substrate available for deubiquitination to facilitate proteasomal degradation. Ddi1 could be a potential selective target for lung cancer treatment. Ddi1 runs as a doublet of 54/56 kDa on acrylamide gels besides the calculated MW 44 kDa.

Specifications

• Accession Number: Q8WTU0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 414301
• Name: Human DDI1 (aa 362-394) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700011N24Rik; DDI1; DDI1, DNA-damage inducible 1, homolog 1; DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae); DNA damage inducible 1 homolog 1; DNA-damage inducible 1 homolog 1; DNA-damage inducible 1 homolog 1 (S. cerevisiae); DNA-damage inducible protein 1; protein DDI1 homolog 1; RGD1559430
• Common Name: DDI1
• Gene Symbol: DDI1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PEGELPLCSRMVSGQDESSDKEITHSVMDSGRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining