missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DDHD2 (aa 119-194) Control Fragment Recombinant Protein

Product Code. 30201353
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201353

Brand: Invitrogen™ RP93745

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54705 (PA5-54705. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDHD2, also known as KIAA0725p, is a member of the intracellular phospholipase A1 (PLA1) protein family which comprises a group of enzymes that hydrolyze the sn-1 ester bond of phospholipids, producing 2-acyl-lysophospholipids and fatty acids. DDHD2 prefers phosphatidic acid as substrate and has a role in efficient membrane trafficking from the Golgi apparatus to the plasma membrane. The gene of DDHD2 maps to chromosome 8p11.23, and encodes a 711-amino-acid protein with a calculated molecular mass of 81 kDa. It has been reported that DDHD2 immunoblot analysis of various tissue extracts revealed two bands of 90 and 85 kDa.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94830
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23259
Name Human DDHD2 (aa 119-194) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010305K11Rik; DDHD domain containing 2; DDHD domain-containing protein 2; Ddhd2; intracellular phospholipase A1gamma; iPLA(1)gamma; KIAA0725; KIAA0725p; mKIAA0725; PA-PLA1 like; phospholipase DDHD2; SAM, WWE and DDHD domain-containing protein 1; Samwd1; sec23p-interacting protein p125-like phosphatidic acid-preferring phospholipase A1; SPG54
Common Name DDHD2
Gene Symbol DDHD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDKDNKYVPYSESFSQVLEETYMLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQGRPRTV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.