Invitrogen™ Human DDB2 (aa 43-182) Control Fragment Recombinant Protein

Product Code. 30194286

Brand: Invitrogen™ RP103330

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Damaged DNA binding protein (DDB) is a heterodimer composed of two subunits, p127 and p48, which are designated DDB1 and DDB2, respectively. The DDB heterodimer is involved in repairing DNA damaged by ultraviolet light. Specifically, DDB, also designated UV-damaged DNA binding protein (UV-DDB), xeroderma pigmentosum group E binding factor (XPE-BF) and hepatitis B virus X-associated protein 1 (XAP-1), binds to damaged cyclobutane pyrimidine dimers (CPDs). Mutations in the DDB2 gene are implicated as causes of xeroderma pigmentosum group E, an autosomal recessive disease in which patients are defective in nucleotide excision DNA repair. XPE is characterized by hypersensitivity of the skin to sunlight with a high frequency of skin cancer as well as neurologic abnormalities. The hepatitis B virus (HBV) X protein interacts with DDB1, which may mediate HBx transactivation.

Specifications

• Accession Number: Q92466
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1643
• Name: Human DDB2 (aa 43-182) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610043A19Rik; damage specific DNA binding protein 2; damage-specific DNA binding protein 2, 48 kDa; damage-specific DNA-binding protein 2; DDB p48 subunit; DDB2; DDBb; DNA damage-binding protein 2; UV-damaged DNA-binding protein 2; UV-DDB 2; UV-DDB2; xeroderma pigmentosum group E protein; XPE
• Common Name: DDB2
• Gene Symbol: DDB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining