missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DDB1 (aa 159-275) Control Fragment Recombinant Protein

Product Code. 30207684
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207684

Brand: Invitrogen™ RP102974

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DNA damage-binding protein from HeLa cells is associated with polypeptides of relative mass 124,000 (DDB1) and 41,000 (DDB2) as determined by SDS-polyacrylamide gels. To test whether the DNA-repair defect in the subset of XPE patients that lack DNA damage-binding activity is caused by a defect in DDB, Keeney et al. (1994) injected purified human DDB protein into XPE cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16531
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1642
Name Human DDB1 (aa 159-275) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 127 kDa; AA408517; damage specific DNA binding protein 1; damaged-DNA recognition protein 1; damage-specific DNA binding protein 1, 127 kDa; damage-specific DNA-binding protein 1; damage-specific DNA-binding protein, DNA repair; DDB p127 subunit; DDB1; DDBa; DNA damage-binding protein 1; DNA damage-binding protein a; DNA repair protein; HBV X-associated protein 1; p127-Ddb1; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; UV-DDB 1; UV-DDB1; XAP1; XAP-1; xeroderma pigmento; Xeroderma pigmentosum group E-complementing protein; XPCE; XPE; XPE-BF; XPE-binding factor
Common Name DDB1
Gene Symbol DDB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.