Invitrogen™ Human DCUN1D3 (aa 206-283) Control Fragment Recombinant Protein

Product Code. 30180812

Brand: Invitrogen™ RP98797

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60396 (PA5-60396. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DCUN1D3 contains 1 DCUN1 domain. The exact function of DCUN1D3 remains unknown.

Specifications

• Accession Number: Q8IWE4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 123879
• Name: Human DCUN1D3 (aa 206-283) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700020A13Rik; 44M2.4; BC030335; DCN1, defective in cullin neddylation 1, domain containing 3; DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae); DCN1-like protein 3; DCN1-like protein 3-like; DCUN1 domain-containing protein 3; DCUN1D3; defective in cullin neddylation 1 domain containing 3; defective in cullin neddylation protein 1-like protein 3; hypothetical protein MGC48972; RGD1308893; SCCRO3; Squamous cell carcinoma-related oncogene 3
• Common Name: DCUN1D3
• Gene Symbol: DCUN1D3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining